PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009771409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 365aa    MW: 41426.6 Da    PI: 4.7724
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009771409.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK69.83.9e-22274323352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      +++l+d + y +lpi+ AAk+L++c+Tv+K+ CR+ G+ RWP+Rkiks+
  XP_009771409.1 274 GKLRLKDFAGYLHLPIEVAAKKLNICPTVMKKVCRRDGLLRWPYRKIKSI 323
                     68999*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.438263343IPR003035RWP-RK domain
PfamPF020421.5E-19276323IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDNPTAIVPY HDPFDDSCSI DQISLFDENP TIGLPKSSWN QEPFSFDPTI LKSDNDFGVY  60
DPFDDPIFLD IPYECKNNLV ENSTNTEAGV FATNYCSISQ DRVFENKSHV SVWPVSSSTS  120
MCTNNCQILR EITHSNGLQI SKLDIFGTLG RISHAVLEKY TRDFSSQSHE SSQIFDFSKD  180
STSSVKQFLV QYFEACKLEG YILLQDPFCD FYEALGVGSD DGDSLDIDSL LQLSPTTSRD  240
CQMNQQEIKN EGEVNCNDMR YEKIPLSAQR ERTGKLRLKD FAGYLHLPIE VAAKKLNICP  300
TVMKKVCRRD GLLRWPYRKI KSIRRKISKR EKSLSSNDVE ERASAKADIA KLEEELAKIF  360
EAFVG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009771409.10.0PREDICTED: uncharacterized protein LOC104221948
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35052027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.14e-07Nin-like family protein